Analytical Data
-
Gene name
GLIS2
- Application
-
Alternative Names
FLJ38247; GLI similar 2; GLI-similar 2; GLIS 2; GLIS family zinc finger 2; glis2; GLIS2_HUMAN; Kruppel like zinc finger protein GLIS2; Neuronal Krueppel-like protein; Zinc finger protein GLIS2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZE0
-
Expression Region
1-524aa
-
AA Sequence
MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
-
Molecular Weight
84.59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLIS2 (GLIS family zinc finger 2) is a transcription factor that belongs to the GLIS gene family, which plays crucial roles in various biological processes, including cell proliferation, differentiation, and apoptosis. Research has indicated that GLIS2 is involved in the regulation of several signaling pathways and is critical for maintaining pluripotency in stem cells. Aberrant expression of GLIS2 has been linked to various diseases, including cancer, making it a significant target for therapeutic interventions. The study of GLIS2 recombinant proteins facilitates the understanding of its structure-function relationship and interaction with other molecular partners. By producing and characterizing recombinant GLIS2 proteins, researchers aim to elucidate the mechanisms through which GLIS2 exerts its biological effects, investigate its role in disease pathogenesis, and explore its potential as a biomarker or therapeutic target. Current advances in molecular biology techniques enable the efficient production and purification of these recombinant proteins, paving the way for in-depth functional assays and structural studies. This research not only contributes to the fundamental understanding of GLIS2 biology but also holds promise for developing novel strategies in disease treatment and regenerative medicine.
