Analytical Data
-
Gene name
GGTLA4
- Application
-
Alternative Names
dJ831C21.1; dJ831C21.2; Gamma glutamyl transpeptidase; Gamma glutamyltransferase-like activity 3; Gamma-glutamyltransferase light chain 1; Gamma-glutamyltransferase-like activity 4; Gamma-glutamyltransferase-like protein 6; GGTL1_HUMAN; GGTL6; GGTLA3; GGTLA4; GGTLC1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BX51
-
Expression Region
1-225aa
-
AA Sequence
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
-
Molecular Weight
50.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GGTLA4, short for "Glycosylated Glypican-4-Like Protein 4," has emerged as a focal point in contemporary biomedical research due to its potential implications in various physiological and pathological processes. Initially discovered as a member of the glypican family, GGTLA4 is believed to play a crucial role in cell signaling pathways, influencing cell development, proliferation, and differentiation. Its expression is particularly notable in the nervous system, raising questions about its involvement in neurodevelopmental disorders and neural regeneration. Recent studies have suggested that GGTLA4 may interact with key signaling molecules and may have implications in cancer biology, particularly in tumor growth and metastasis. The recombinant protein form of GGTLA4 has been produced to facilitate detailed investigations into its structure-function relationships and physiological roles. By generating the recombinant protein, researchers aim to elucidate the mechanisms by which GGTLA4 exerts its biological functions, identify potential therapeutic targets, and explore its utility in diagnostics. Additionally, GGTLA4 is also under examination for its participation in glycan-mediated cell interactions, making it a significant candidate for further exploration in tissue engineering and regenerative medicine. As our understanding of GGTLA4 expands, its potential applications in targeted therapies and as a biomarker for disease continue to be areas of significant interest within the scientific community.
