Analytical Data
-
Gene name
GLIPR1L2
- Application
-
Alternative Names
GLIPR1L2; GLIPR1-like protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4G1C9
-
Expression Region
1-253aa
-
AA Sequence
MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC
-
Molecular Weight
55.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLIPR1L2 (GLI Pathway Inhibitory Regulator 1 Like 2) is a recently identified gene that plays a significant role in the regulation of the Hedgehog signaling pathway, which is crucial for various developmental processes and tissue homeostasis. Research has shown that abnormalities in Hedgehog signaling are associated with several cancers and developmental disorders, making GLIPR1L2 an important candidate for understanding these conditions. The study of GLIPR1L2 recombinant protein is pivotal for elucidating its biological functions and mechanisms of action. By producing and investigating the recombinant protein, scientists can explore its interactions with other molecular players in the Hedgehog pathway, assess its effects on cell proliferation and differentiation, and determine its potential as a therapeutic target. Additionally, the characterization of GLIPR1L2 may shed light on its role in modulating cellular signaling and contribute to the broader understanding of cancer biology. As research continues to uncover the intricacies of GLIPR1L2, it may hold promise for novel therapeutic interventions aimed at mitigating the consequences of aberrant Hedgehog signaling in various diseases.
