Analytical Data
-
Gene name
GLIPR1L1
- Application
-
Alternative Names
GLIPR1L1; UNQ2972/PRO7434GLIPR1-like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWM5
-
Expression Region
1-233aa
-
AA Sequence
MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF
-
Molecular Weight
52.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLIPR1L1, a member of the GLIPR family of genes, has garnered attention in recent years due to its potential roles in cancer biology and development. This gene is believed to encode a protein involved in various cellular processes, including apoptosis, cell proliferation, and differentiation. Recent studies have suggested that GLIPR1L1 may act as a tumor suppressor, with its expression levels showing correlations with certain cancer types, indicating its significance in tumorigenesis. Given the importance of understanding the molecular mechanisms underlying cancer, the recombinant protein of GLIPR1L1 has been a focus of research, allowing scientists to investigate its functional roles in vitro and in vivo. The recombinant GLIPR1L1 protein can be utilized in various assays to elucidate its interactions with other cellular proteins, its signaling pathways, and its potential as a therapeutic target. Moreover, studying this protein can help clarify the biological roles of GLIPR1L1 in normal physiological processes and pathological conditions, paving the way for novel cancer treatment strategies. As such, the characterization and functional analysis of GLIPR1L1 recombinant protein are essential for advancing our understanding of its implications in health and disease.
