Analytical Data
-
Gene name
GGCX
- Application
-
Alternative Names
GGCX; GC; Vitamin K-dependent gamma-carboxylase; Gamma-glutamyl carboxylase; Peptidyl-glutamate 4-carboxylase; Vitamin K gamma glutamyl carboxylase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P38435
-
Expression Region
533-629aa
-
AA Sequence
ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS
-
Molecular Weight
36.41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the recombinant GGCX (gamma-glutamyl carboxylase) protein has gained significant attention due to its crucial role in the post-translational modification of various vitamin K-dependent proteins. GGCX is essential for the carboxylation of specific glutamic acid residues, which is vital for the biological activity of clotting factors such as prothrombin and several matrix Gla-proteins involved in bone and cardiovascular health. Deficiencies or defects in GGCX can lead to serious clinical conditions, including bleeding disorders and cardiovascular diseases. Recent advances in molecular biology techniques have enabled the expression and purification of recombinant GGCX, allowing for in-depth studies into its mechanisms and interactions. Understanding the structure-function relationship of GGCX through recombinant methods has potential implications for therapeutic interventions, including the development of novel anticoagulant therapies or protein engineering strategies aimed at enhancing the enzyme's activity or stability. Moreover, the ability to produce GGCX in a recombinant system opens avenues for investigating its regulatory pathways and genetic variations that affect its functional capacity, thereby contributing to the broader field of coagulation research and patient management strategies.
