Analytical Data
-
Gene name
GLI4
- Application
-
Alternative Names
GLI4; HKR4Zinc finger protein GLI4; Krueppel-related zinc finger protein 4; Protein HKR4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10075
-
Expression Region
1-376aa
-
AA Sequence
MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE
-
Molecular Weight
67.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLI4 is a member of the GLI family of transcription factors, which play crucial roles in cellular processes such as development, differentiation, and tissue homeostasis. Research has indicated that GLI4 is involved in various signaling pathways, including the Hedgehog signaling pathway, which is pivotal for embryonic development and has been implicated in several cancers. Its overexpression or mutation can lead to aberrant gene regulation and contribute to tumorigenesis. The study of GLI4 recombinant proteins has gained traction in recent years, aimed at understanding its structure-function relationship, regulatory mechanisms, and interactions with other cellular components. By producing GLI4 as a recombinant protein, researchers can investigate its biochemical properties, post-translational modifications, and the impact of specific mutations on its function. This research not only enhances our comprehension of GLI4's role in normal physiology but also provides insights into its contribution to cancer progression and potential as a therapeutic target. Through the development of GLI4 inhibitors or modulators, there is significant hope for therapeutic advancements in treating GLI4-associated malignancies, making this area of study both timely and impactful in cancer research and drug development.
