Analytical Data
-
Gene name
GFOD1
- Application
-
Alternative Names
GFOD1; C6orf114Glucose-fructose oxidoreductase domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXC2
-
Expression Region
1-390aa
-
AA Sequence
MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
-
Molecular Weight
69.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GFOD1 (GTPase final output domain 1) is a relatively recent discovery in the realm of molecular biology, emerging as a significant player in cellular processes, particularly in relation to nucleotide metabolism and signaling pathways. Initially identified through bioinformatics approaches and high-throughput sequencing, GFOD1 is believed to be involved in the synthesis and regulation of guanine nucleotides, which are vital for various biological functions, including cell proliferation, differentiation, and apoptosis. Given the critical role of guanine nucleotides in cellular signaling, abnormalities in GFOD1 expression or function could potentially link it to various pathophysiological conditions, including cancer and neurological disorders. Research has increasingly focused on characterizing GFOD1 at the molecular level, leading to the development of recombinant GFOD1 proteins for functional studies. These studies aim to elucidate its biochemical properties, interaction partners, and functional implications within cellular contexts. Understanding GFOD1's mechanisms of action could offer novel insights into therapeutic targets and biomolecular pathways, enhancing our overall comprehension of cellular homeostasis and disease mechanisms. Consequently, unraveling the complexities surrounding GFOD1 not only holds promise for advancing basic science but also for advancing clinical applications in health and disease management.
