Analytical Data
-
Gene name
GIMAP2
- Application
-
Alternative Names
GIMAP2; IMAP2; GTPase IMAP family member 2; Immunity-associated protein 2; hIMAP2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UG22
-
Expression Region
1-337aa
-
AA Sequence
MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
-
Molecular Weight
64.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GIMAP2 (GTPase of immunity-associated protein 2) is a member of the GIMAP family, which is crucial in regulating immune responses, particularly within T lymphocytes. This protein is encoded by a gene located within the immune-related chromosome 7 and is implicated in various physiological and pathological processes, including lymphocyte development and survival. Studies have revealed that GIMAP2 plays a pivotal role in maintaining the homeostasis of T cells, and its dysregulation has been linked to autoimmune diseases and certain cancers. Research efforts have increasingly focused on producing recombinant GIMAP2 proteins to elucidate their functional roles and interactions within the immune system. By employing techniques such as molecular cloning and expression systems, scientists aim to generate sufficient quantities of GIMAP2 for biochemical assays, structural studies, and potential therapeutic applications. Understanding the detailed mechanisms by which GIMAP2 influences T cell behavior may provide insights into novel strategies for modulating immune responses, enhancing vaccine efficacy, or developing targeted therapies for autoimmune disorders. Overall, the study of GIMAP2 and its recombinant protein forms represents a significant frontier in immunology, with implications for both fundamental research and clinical applications.
