Analytical Data
-
Gene name
GALNAC4S-6ST
- Application
-
Alternative Names
B cell RAG associated gene protein; B cell RAG associated protein; B-cell RAG-associated gene protein; BRAG; Carbohydrate sulfotransferase 15; Chst15; CHSTF_HUMAN; GALNAC4S 6ST; GalNAc4S-6ST; hBRAG; KIAA0598
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7LFX5
-
Expression Region
1-561aa
-
AA Sequence
MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT
-
Molecular Weight
87.45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GALNAC4S-6ST, or GalNAc 4-O-sulfotransferase, is a key enzyme involved in the biosynthesis of sulfated glycosaminoglycans, particularly heparan sulfate and keratan sulfate. These glycosaminoglycans play crucial roles in various biological processes, including cell signaling, development, and inflammation. The regulation of sulfation patterns by enzymes like GALNAC4S-6ST is vital for maintaining cellular functions and tissue homeostasis. Aberrant sulfation has been associated with several pathologies, including cancer, inflammation, and various genetic disorders. Therefore, studying the structure and function of GALNAC4S-6ST is of significant interest in glycobiology and therapeutic development. Understanding its enzymatic mechanism, substrate specificity, and regulatory pathways could unveil new insights into glycosaminoglycan-related diseases and facilitate the design of targeted therapies or biotechnological applications. Furthermore, recombinant protein production of GALNAC4S-6ST allows for detailed biochemical characterization and potential applications in drug development, highlighting its relevance in both basic and applied research contexts.
