Analytical Data
-
Gene name
FRAT2
- Application
-
Alternative Names
FRAT2GSK-3-binding protein FRAT2; Frequently rearranged in advanced T-cell lymphomas 2; FRAT-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75474
-
Expression Region
1-233aa
-
AA Sequence
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
-
Molecular Weight
50.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FRAT2 (frequently rearranged in advanced T-cell lymphoma 2) is a crucial protein involved in the Wnt signaling pathway, which plays a significant role in cell proliferation, differentiation, and embryonic development. Abnormalities in the Wnt pathway, often linked to various cancers, highlight the importance of understanding FRAT2's function and mechanism. Research has shown that FRAT2 acts as an inhibitor of glycogen synthase kinase-3 (GSK-3), thereby stabilizing β-catenin, a key regulator in the Wnt signaling cascade. The overexpression or mutation of FRAT2 has been associated with several malignancies, including colorectal, breast, and liver cancers, suggesting its potential as a biomarker and therapeutic target. Consequently, the study of recombinant FRAT2 protein aims to elucidate its structural and functional properties, paving the way for the development of novel cancer therapies that could disrupt aberrant Wnt signaling. By producing and characterizing FRAT2 in a recombinant system, researchers seek to explore its interactions with other signaling molecules and to investigate how its inhibition can influence cancer cell behavior. This research not only enhances our understanding of tumor biology but also opens up new avenues for the design of targeted treatments that could mitigate the effects of Wnt pathway dysregulation in cancer.
