Analytical Data
-
Gene name
MUC1
- Application
-
Alternative Names
MUC1；PUM；Mucin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15941
-
Expression Region
1095-1140aa
-
AA Sequence
LRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSG
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MUC1, a high molecular weight glycoprotein, is primarily expressed on the surface of epithelial cells and is known for its significant role in protecting mucosal surfaces. Abnormal expression of MUC1 is associated with a variety of cancers, including breast, colorectal, and pancreatic cancers, making it an important target for cancer research and immunotherapy. The interest in MUC1 recombinant proteins has surged due to their potential applications in vaccine development, where they can elicit specific immune responses against tumor cells that express the MUC1 antigen. Furthermore, recombinant MUC1 proteins serve as valuable tools in understanding the molecular mechanisms of cancer progression and metastasis. Recent advancements in recombinant DNA technology, including techniques such as protein engineering and fusion protein generation, have enabled the production of these proteins with enhanced stability and immunogenicity. Researchers are exploring MUC1-based vaccines that can train the immune system to recognize and attack cancer cells more effectively. Additionally, MUC1's role in regulating cell signaling pathways, glycosylation patterns, and interactions with the tumor microenvironment are under investigation, providing insights that could lead to novel therapeutic strategies. As a result, MUC1 recombinant proteins are garnering increased attention in both basic research and clinical contexts, highlighting their potential to contribute significantly to the field of targeted cancer therapy and vaccine design.
