Analytical Data
-
Gene name
APOF
- Application
-
Alternative Names
APOF；ApolipoProtein F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13790
-
Expression Region
37-327aa
-
AA Sequence
TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFL VSLALRNDALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRS TERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQL LPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVS DLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOF (apolipoprotein F) is a protein implicated in lipid metabolism and cardiovascular health, making it a significant focus in biomedical research. It has been found to play a crucial role in the transport and metabolism of lipoproteins, influencing cholesterol homeostasis and potentially contributing to the pathogenesis of atherosclerosis. Given the increasing prevalence of metabolic disorders and cardiovascular diseases globally, understanding the functional mechanisms and interactions of APOF is vital for developing therapeutic interventions. Recent advances in biotechnology allow for the recombinant expression and purification of APOF, facilitating in-depth studies of its structural and functional properties. Researchers aim to explore the protein's role in lipid transport, its potential as a biomarker for cardiovascular risk, and its interactions with other apolipoproteins and lipid metabolism pathways. This research has far-reaching implications for improving diagnostic tools and therapeutic strategies in treating lipid-related diseases. Additionally, the development of recombinant APOF may pave the way for new avenues in drug delivery systems, enhancing the bioavailability and efficacy of therapeutic agents. Overall, the ongoing studies on recombinant APOF are essential for elucidating its biological functions and translating this knowledge into clinical applications that can mitigate health risks associated with dyslipidemia and cardiovascular conditions.
