Analytical Data
-
Gene name
APOC4
- Application
-
Alternative Names
APOC4；ApolipoProtein C-IV
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55056
-
Expression Region
27-127aa
-
AA Sequence
CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
-
Molecular Weight
13.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOC4, or Apolipoprotein C4, is a member of the apolipoprotein family, which plays a crucial role in lipid metabolism and cardiovascular health. Recent research has increasingly focused on its involvement in various metabolic disorders, including obesity and type 2 diabetes. APOC4 is known to modulate lipid transport and interaction with other apolipoproteins, thereby influencing triglyceride levels and overall lipid profiles in the bloodstream. Despite its pivotal role, the exact mechanisms underlying APOC4's function and its potential as a therapeutic target remain inadequately understood. Studies have indicated that alterations in APOC4 expression can lead to dyslipidemia, which is a significant risk factor for cardiovascular diseases. Therefore, the recombination and expression of APOC4 proteins for functional studies have garnered significant interest. By utilizing recombinant DNA technology, researchers aim to produce large quantities of APOC4 for in-depth biochemical assays and structural analysis. This research not only enhances our understanding of APOC4's role in lipid metabolism but also paves the way for developing targeted therapies for metabolic diseases linked to dyslipidemia. Understanding APOC4's structure and function could eventually lead to novel interventions for managing lipid-related disorders and reducing cardiovascular risks associated with aberrant lipid profiles. The ongoing exploration of APOC4, particularly through the lens of recombinant protein technology, represents a promising frontier in cardiovascular and metabolic health research.
