Analytical Data
-
Gene name
Clec6a
- Application
-
Alternative Names
Clec6a; Clec4n; Clecsf10
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His and TRxA Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9JKF4
-
Expression Region
44-209aa
-
AA Sequence
IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKE NFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQW IDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMK KIYL
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Clec6a, also known as Dectin-1, is a C-type lectin receptor that plays a crucial role in the immune system, particularly in the recognition of fungal pathogens. Its significance lies in the fact that it enhances the host's innate immune response by mediating the detection of beta-glucans, a component found in the cell walls of fungi. Research on Clec6a recombinant protein has gained momentum due to its potential applications in immunotherapy and vaccine development. Understanding the structure and function of Clec6a can elucidate its role in fungal infections and other immunological processes. Furthermore, recombinant Clec6a proteins can serve as vital tools for studying signaling pathways involved in immune responses and for developing diagnostic assays or therapeutic agents targeting fungal infections. The exploration of Clec6a not only paves the way for novel therapeutic strategies but also sheds light on the intricate mechanisms of the immune system in pathogen recognition and response. This research thus holds promise for enhancing therapeutic outcomes in patients with immunocompromised states or those undergoing treatments that increase their susceptibility to fungal infections.
