Analytical Data
-
Gene name
APOC3
- Application
-
Alternative Names
APOC3；ApolipoProtein C-III
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02656
-
Expression Region
21-99aa
-
AA Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
-
Molecular Weight
24.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOC3, or Apolipoprotein C-III, is a protein primarily produced in the liver and small intestine, playing a crucial role in lipid metabolism and influencing triglyceride levels in plasma. Recent studies have illuminated its significant involvement in various metabolic disorders, including hypertriglyceridemia, cardiovascular diseases, and type 2 diabetes. As a critical component of lipoproteins, APOC3 acts by inhibiting lipoprotein lipase, thus impeding the clearance of triglyceride-rich lipoproteins from the bloodstream. This has drawn considerable attention to its potential as a therapeutic target, as modulation of APOC3 levels could lead to innovative strategies for managing lipid disorders. Furthermore, genetic variants of APOC3 have been associated with altered lipid profiles and cardiovascular risks, illustrating its importance in personalizing treatment approaches. Research into recombinant forms of APOC3 protein has expanded, enabling investigations into its structure-function relationships, interactions with other lipoproteins, and its role in related metabolic pathways. Advances in recombinant protein production techniques have paved the way for detailed studies into the mechanistic aspects of APOC3, providing insights that could eventually facilitate the design of APOC3-targeted therapies aimed at reducing cardiovascular risk and improving metabolic health. As understanding of APOC3 continues to evolve, it holds promise not only for elucidating the complexities of lipid metabolism but also for developing novel interventions to combat metabolic diseases.
