Analytical Data
-
Gene name
CD1d
- Application
-
Alternative Names
Cd1d1, Cd1.1
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11609
-
Expression Region
56-271aa
-
AA Sequence
HRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPK EDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDL PIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSS ADGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDV
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD1d is a non-classical MHC class I molecule crucial for the presentation of lipid antigens to NKT cells, a unique subset of T lymphocytes. Research on CD1d recombinant proteins has gained significant attention due to their potential implications in immunology and therapeutic applications. The study of CD1d is pivotal in understanding the mechanisms underlying immune responses, particularly the regulation of innate and adaptive immunity. CD1d molecules are primarily expressed on antigen-presenting cells and are essential for the recognition of foreign lipids, thus bridging the gap between the innate and adaptive immune systems. Advances in biotechnology have enabled the production of CD1d recombinant proteins, which allows for detailed structural and functional analyses. These studies can lead to new insights into the development of innovative vaccines, as well as targeted therapies for autoimmune diseases, cancer, and infections. By elucidating the interactions between CD1d and various lipid antigens, researchers aim to harness the power of NKT cells in directing immune responses, potentially enhancing therapeutic efficacy and improving patient outcomes. Overall, the exploration of CD1d recombinant proteins presents exciting opportunities for the advancement of immunotherapy and the treatment of a range of immune-related conditions.
