Cat: PA3000-1017

Recombinant Mouse CD44 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD44

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD44 antigen; CDw44; Epican; ECMR-III; CD44; LHR; MDU2

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    12505 [NCBI]

  • Expression Region

    Q25-T224

  • AA Sequence

    QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD44 is a cell surface glycoprotein that plays a critical role in cell-cell interactions, cell adhesion, and migration. It is widely expressed on various cell types and is involved in numerous physiological and pathological processes, including immune response, inflammation, and tumor metastasis. The diverse functions of CD44 are largely attributed to its ability to bind to hyaluronan (HA) and other ligands, which are essential for maintaining tissue homeostasis and facilitating cellular communication. Given its significance in cancer progression and immune regulation, CD44 has become a focal point in biomedical research. Researchers have developed recombinant CD44 proteins to investigate its structural and functional properties, elucidate signaling pathways, and explore its role in disease mechanisms. The production of recombinant CD44 allows for detailed studies of its interactions with ligands and other cellular components in controlled settings, aiding in the identification of potential therapeutic targets. Additionally, alterations in CD44 expression and isoform diversity are associated with various diseases, making it a promising biomarker for diagnosis and prognosis. Overall, investigating CD44 recombinant proteins enhances our understanding of its multifaceted roles in health and disease, providing insight into potential strategies for clinical intervention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US