Analytical Data
-
Gene name
CD44
- Application
-
Alternative Names
CD44 antigen; CDw44; Epican; ECMR-III; CD44; LHR; MDU2
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
12505 [NCBI]
-
Expression Region
Q25-T224
-
AA Sequence
QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD44 is a cell surface glycoprotein that plays a critical role in cell-cell interactions, cell adhesion, and migration. It is widely expressed on various cell types and is involved in numerous physiological and pathological processes, including immune response, inflammation, and tumor metastasis. The diverse functions of CD44 are largely attributed to its ability to bind to hyaluronan (HA) and other ligands, which are essential for maintaining tissue homeostasis and facilitating cellular communication. Given its significance in cancer progression and immune regulation, CD44 has become a focal point in biomedical research. Researchers have developed recombinant CD44 proteins to investigate its structural and functional properties, elucidate signaling pathways, and explore its role in disease mechanisms. The production of recombinant CD44 allows for detailed studies of its interactions with ligands and other cellular components in controlled settings, aiding in the identification of potential therapeutic targets. Additionally, alterations in CD44 expression and isoform diversity are associated with various diseases, making it a promising biomarker for diagnosis and prognosis. Overall, investigating CD44 recombinant proteins enhances our understanding of its multifaceted roles in health and disease, providing insight into potential strategies for clinical intervention.
