Analytical Data
-
Gene name
VDAC2
- Application
-
Alternative Names
B-36 vdac; FLJ23841; hVDAC2; OTTHUMP00000019878; OTTHUMP00000019879; OTTHUMP00000019880; Outer mitochondrial membrane Protein porin 2; POR; Porin-2; VDAC 2; VDAC-2; VDAC2; VDAC2_HUMAN; Vdac6; Voltage dependent anion channel 2; Voltage dependent anion selective channel Protein 2; Voltage-dependent anion-selective channel Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P45880
-
Expression Region
1-283 aa
-
AA Sequence
MCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
-
Molecular Weight
56.65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Voltage-dependent anion channel 2 (VDAC2) is a highly studied protein found in the outer mitochondrial membrane, playing a critical role in cellular metabolism and apoptosis. VDAC2 is known to facilitate the transport of metabolites and ions across the mitochondrial membrane, thus being essential for maintaining mitochondrial function and energy production. Dysregulation of VDAC2 has been linked to various diseases, including cancer and neurodegenerative disorders, making it a potential target for therapeutic intervention. Research has shown that VDAC2 interacts with various proteins involved in cellular signaling pathways, highlighting its involvement in regulating cell death and survival. The recombinant expression of VDAC2 allows for detailed structural and functional studies, improving our understanding of its role in mitochondrial physiology. Advances in recombinant protein technology have paved the way for obtaining large quantities of functional VDAC2, enabling investigations into its biophysical properties, interactions with ligands, and implications in pathophysiological conditions. This research not only contributes to the basic understanding of mitochondrial dynamics but also aids in the development of novel strategies for treating diseases associated with mitochondrial dysfunction. As such, the study of recombinant VDAC2 remains a focal point in mitochondrial research, offering insights that could lead to innovative therapeutic approaches.
