Analytical Data
-
Gene name
HRH1
- Application
-
Alternative Names
HRH1；Histamine H1 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35367
-
Expression Region
211-416aa
-
AA Sequence
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
-
Molecular Weight
27.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HRH1, or the histamine receptor H1, is a crucial member of the histamine receptor family and plays a significant role in various physiological processes, including allergic responses, neurotransmission, and regulation of immune function. Recent studies highlight the importance of HRH1 in mediating allergic reactions and inflammatory processes, making it a target for drug discovery, especially for antihistamines and other therapeutic agents. The recombinant expression of HRH1 protein has enabled researchers to investigate its structural and functional properties more effectively. By producing HRH1 in heterologous systems, such as bacteria or mammalian cells, scientists can obtain a sufficient quantity of biologically active protein for detailed studies. Understanding the 3D structure of HRH1 and its interaction with ligands can facilitate the design of more selective and effective drugs, potentially leading to better management of conditions like allergic rhinitis, asthma, and other histamine-related disorders. Moreover, recombinant HRH1 is fundamental in developing biochemical assays and screening platforms to identify novel compounds that target this receptor. Consequently, research into HRH1 recombinant protein not only contributes to the broader understanding of receptor biology but also presents promising avenues for therapeutic innovations in treating histamine-related diseases.
