Analytical Data
-
Gene name
USP19
- Application
-
Alternative Names
8430421I07Rik; AI047774; Deubiquitinating enzyme 19; Ubiquitin carboxyl terminal hydrolase 19; Ubiquitin carboxyl-terminal hydrolase 19; Ubiquitin specific peptidase 19; Ubiquitin specific processing protease 19; Ubiquitin specific protease 19; Ubiquitin thioesterase 19; Ubiquitin thiolesterase 19; Ubiquitin-specific-processing protease 19; UBP19_HUMAN; Usp19; Zinc finger MYND domain containing Protein 9; Zinc finger MYND domain-containing Protein 9; ZMYND9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O94966
-
Expression Region
1-217 aa
-
AA Sequence
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESDKCDRIQENSS
-
Molecular Weight
49.61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
USP19, a member of the ubiquitin-specific protease family, plays a crucial role in regulating protein degradation by reversing ubiquitination, thereby impacting various cellular processes, including cell cycle progression, apoptosis, and stress responses. Research into USP19 has gained momentum due to its implications in cancer biology and other diseases, where altered ubiquitination patterns can contribute to tumor development and progression. Studies have shown that USP19 can stabilize certain oncoproteins, suggesting its potential as a therapeutic target. Additionally, its involvement in the endoplasmic reticulum-associated degradation (ERAD) pathway highlights its importance in maintaining cellular homeostasis. Recent findings indicate that USP19 may modulate innate immune responses and influence the pathogenesis of neurodegenerative diseases. The recombinant expression of USP19 protein has become essential for elucidating its biochemical functions and interactions within these pathways. Advances in recombinant protein techniques allow for the production of USP19 in sufficient quantities for functional assays and structural studies, facilitating a deeper understanding of its mechanisms of action and potential as a drug target. Overall, ongoing research into USP19 promises to shed light on its multifaceted roles in health and disease, paving the way for innovative therapeutic strategies.
