Analytical Data
-
Gene name
FLJ41423
- Application
-
Alternative Names
Putative uncharacterized protein FLJ41423
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1L4Q6
-
Expression Region
1-167aa
-
AA Sequence
MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFCAGCRQGPSVWSCGEPVPRRIWVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEERESANIY
-
Molecular Weight
18.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ41423 is a recombinant protein that has garnered significant interest in the field of molecular biology and biotechnology due to its potential applications in various biomedical research areas. Initially identified through cDNA library screening, FLJ41423 is believed to encode a protein that plays a role in cellular processes, although its exact biological function remains largely unexplored. The growing demand for novel proteins in therapeutic development and diagnostic tools has prompted researchers to investigate FLJ41423 further. The protein's unique features, such as its expression patterns and structural properties, make it a candidate for studies related to cell signaling, immune responses, and disease mechanisms. Moreover, by utilizing recombinant DNA technology, scientists aim to produce FLJ41423 in a more controlled manner, enabling detailed studies of its functional characteristics and interactions with other biomolecules. Understanding the role of FLJ41423 could potentially lead to insights into disease pathways, paving the way for new therapeutic strategies. Overall, the research surrounding FLJ41423 exemplifies the broader trend of leveraging recombinant proteins to uncover biological complexities and address unmet medical needs.
