Analytical Data
-
Gene name
ZSWIM7
- Application
-
Alternative Names
Zinc finger SWIM domain-containing protein 7. SWIM domain-containing and Srs2-interacting protein 1 homolog. SWIM-type zinc finger domain-containing protein 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q19AV6
-
Expression Region
1-140 aa
-
AA Sequence
MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZSWIM7, a member of the ZSWIM family of proteins, has emerged as a significant focus of research due to its potential roles in cellular processes and disease mechanisms. This protein contains a unique combination of zinc finger motifs, which are critical for DNA binding and protein-protein interactions, suggesting its involvement in regulating gene expression and chromatin remodeling. Initial studies have linked ZSWIM7 to various biological functions, including cell proliferation, apoptosis, and differentiation, indicating its importance in developmental biology and disease states. Aberrant expression or mutations in ZSWIM7 have been associated with several cancers, highlighting its potential as a biomarker and therapeutic target. Research efforts have increasingly aimed at elucidating the molecular pathways influenced by ZSWIM7, as well as its interactions with other key proteins in the cellular environment. Understanding the precise mechanisms by which ZSWIM7 operates could pave the way for novel interventions in cancer treatment and regenerative medicine, making it an intriguing subject for ongoing investigations in molecular biology and clinical research.
