Analytical Data
-
Gene name
UNC50
- Application
-
Alternative Names
UNC50; UNCL; HSD-23; HSD23; Protein unc-50 homolog; Periodontal ligament-specific Protein 22; PDLs22; Protein GMH1 homolog; hGMH1; Uncoordinated-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53HI1
-
Expression Region
1-259 aa
-
AA Sequence
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK
-
Molecular Weight
56.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNC50 is a protein that plays a crucial role in the regulation of cellular processes, particularly in neuronal development and function. Initially identified in the model organism *Caenorhabditis elegans*, UNC50 is part of the evolutionarily conserved protein family involved in synaptic transmission and neuronal signaling. Its significance has garnered attention due to its involvement in various neurological disorders. Recent studies have focused on the recombinant expression of UNC50 to facilitate detailed investigations into its structure-function relationships. This recombinant protein can be utilized in biochemical assays to examine its interaction with other synaptic proteins and to explore its potential role in synaptic plasticity and neuronal health. Understanding UNC50's mechanism may offer insights into neuronal pathologies and therapeutic targets for diseases such as Alzheimer's and other neurodegenerative conditions. By delving into the properties of recombinant UNC50, researchers aim to elucidate its biological functions and its contributions to cell signaling pathways, ultimately enhancing our comprehension of complex neural networks and developing novel strategies for intervention in neurological diseases.
