Analytical Data
-
Gene name
ZSCAN2
- Application
-
Alternative Names
Zinc finger and SCAN domain-containing protein 2. Zinc finger protein 29 homolog. Zfp-29. Zinc finger protein 854
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7L9
-
Expression Region
1-150 aa
-
AA Sequence
MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSAVAVFASLPVEVTSL
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZSCAN2 is a member of the Zinc Finger family of transcription factors, implicated in various biological processes including stem cell maintenance, differentiation, and the regulation of immune responses. Its expression is tightly regulated during embryonic development and in mature tissues, suggesting a critical role in cellular identity and function. Recent studies have highlighted ZSCAN2's involvement in pluripotency, with its overexpression being linked to the enhanced reprogramming of somatic cells into induced pluripotent stem cells (iPSCs). Additionally, ZSCAN2 has been shown to impact the epigenetic landscape, influencing gene expression patterns that define cellular states. Research into ZSCAN2 recombinant proteins aims to elucidate its mechanisms of action at a molecular level, providing insights into its role in development and disease. Understanding the functionality of ZSCAN2 and its pathways could unveil new therapeutic strategies in regenerative medicine and cancer treatment, where aberrations in transcription factor activity often play a pivotal role. As such, the production and characterization of ZSCAN2 recombinant proteins remain a significant area of interest in molecular biology, facilitating advanced studies on gene regulation, cellular processes, and the development of biotechnological applications.
