Analytical Data
-
Gene name
FLJ14981
- Application
-
Alternative Names
MPND. FLJ14981. hCG_2004608
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
W4VSR2
-
Expression Region
1-471aa
-
AA Sequence
MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS
-
Molecular Weight
77.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ14981, now officially designated as “FAM120A,” is a gene that encodes a protein involved in various cellular processes, particularly in maintaining cellular homeostasis and responding to stress. Initially, it was identified for its potential role in regulating the proliferation and differentiation of cells, drawing attention for its implications in developmental biology and cancer research. The importance of FLJ14981 in signal transduction pathways highlights its potential as a target for therapeutic interventions. Studies have suggested that FLJ14981 interacts with key molecular pathways, such as the mTOR and PI3K/Akt pathways, which are crucial in metabolic regulation and cell survival. Further investigation into the expression patterns and functional roles of FLJ14981 has unveiled its involvement in cellular stress responses, apoptosis, and oncogenesis. Importantly, researchers have been focusing on recombinantly producing FLJ14981 to elucidate its biochemical properties, understand its structural features, and explore its potential as a biomarker or therapeutic target in diseases. The recombinant protein's availability allows for detailed functional assays and manipulations to assess its role in various cellular contexts, paving the way for novel insights into disease mechanisms and therapeutic strategies.
