Analytical Data
-
Gene name
PRDM1
- Application
-
Alternative Names
PRDM1；BLIMP1；PR domain zinc finger Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75626-2
-
Expression Region
1-109aa
-
AA Sequence
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN LLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFW RIYSRGELH
-
Molecular Weight
38 kD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRDM1, also known as Blimp-1, is a transcription factor critically involved in the regulation of immune responses and cell differentiation. It plays a vital role in various biological processes, including B and T cell differentiation, development of plasma cells, and the regulation of the immune system. Research has shown that PRDM1 is essential for the formation of plasma cells that produce antibodies, thus contributing to humoral immunity. Its dysfunction is linked to several pathologies, including autoimmunity and certain types of cancer, making it an important target for therapeutic intervention. Additionally, PRDM1's role in suppressing oncogenic pathways highlights its potential as a tumor suppressor, especially in hematological malignancies. The study of recombinantly expressed PRDM1 protein allows researchers to better understand its functional mechanisms, post-translational modifications, and interactions with other proteins. This knowledge can further our understanding of immune regulation and open up new avenues for developing treatments for immune-related diseases and cancers.
