Analytical Data
-
Gene name
ZNF85
- Application
-
Alternative Names
Zinc finger Protein 85. Zinc finger Protein HPF4. Zinc finger Protein HTF1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03923
-
Expression Region
1-536 aa
-
AA Sequence
MSLSAQPSSSFYKPVSEVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIHTGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI
-
Molecular Weight
88.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF85, a member of the zinc finger protein family, has garnered significant attention in recent years due to its potential roles in cancer biology and gene regulation. It is characterized by multiple zinc finger motifs that enable it to bind to specific DNA sequences, influencing transcriptional activity and playing a role in various cellular processes, including differentiation, proliferation, and apoptosis. Research has indicated that ZNF85 may function as a tumor suppressor, with its expression often downregulated in various types of cancer, suggesting a crucial role in maintaining genomic stability and regulating cell growth. Additionally, recent studies have highlighted the importance of ZNF85 in the modulation of signaling pathways involved in oncogenesis and cellular stress responses. The recombinant expression of ZNF85 allows for detailed investigations into its biochemical properties, interactions with other proteins, and functional consequences in cellular models. Understanding the molecular mechanisms by which ZNF85 operates could provide valuable insights into its potential as a therapeutic target and aid in the development of novel cancer treatments. As such, ZNF85 recombinant protein research is pivotal in bridging gaps in knowledge about its function and therapeutic implications in cancer and other related diseases.
