Cat: PA2000-7696

Recombinant Human FLJ11305 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FLJ11305

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSN12 like protein; CSN12-like protein; DKFZp686C20226; F10; FLJ11305; FLJ99362; HT004; MGC16774; PCI domain containing 2; PCI domain containing protein 2; PCI domain-containing protein 2; PCID2; PCID2_HUMAN; RP11 - 98F14.6

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5JVF3

  • Expression Region

    1-399aa

  • AA Sequence

    MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLLKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYVSHQHQKLVVSKQNPFPPLSTVC

  • Molecular Weight

    69.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FLJ11305 is a recombinant protein that has garnered attention in recent research due to its potential roles in various biological processes and disease mechanisms. Initially, this protein was identified through cDNA libraries and exhibited significant expression across different tissues, indicating its likely involvement in fundamental cellular functions. Its precise physiological role remains largely unclear, but preliminary studies suggest that FLJ11305 may be related to stress response pathways and cellular signaling mechanisms. Researchers have hypothesized that dysregulation of FLJ11305 expression could be linked to certain pathological conditions, including cancer and metabolic disorders. Advances in recombinant protein technology have enabled scientists to produce FLJ11305 in a laboratory setting, facilitating further investigation into its structure and function. Various experimental approaches, including crystallography and molecular biology techniques, are being employed to elucidate the protein's three-dimensional conformation and interaction with other cellular components. Understanding the biological significance of FLJ11305 could provide insights into its potential as a therapeutic target or biomarker for specific diseases. Ongoing studies aim to unravel the molecular underpinnings of FLJ11305 and contribute to a broader understanding of its role in human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US