Analytical Data
-
Gene name
FLJ11305
- Application
-
Alternative Names
CSN12 like protein; CSN12-like protein; DKFZp686C20226; F10; FLJ11305; FLJ99362; HT004; MGC16774; PCI domain containing 2; PCI domain containing protein 2; PCI domain-containing protein 2; PCID2; PCID2_HUMAN; RP11 - 98F14.6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JVF3
-
Expression Region
1-399aa
-
AA Sequence
MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLLKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYVSHQHQKLVVSKQNPFPPLSTVC
-
Molecular Weight
69.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ11305 is a recombinant protein that has garnered attention in recent research due to its potential roles in various biological processes and disease mechanisms. Initially, this protein was identified through cDNA libraries and exhibited significant expression across different tissues, indicating its likely involvement in fundamental cellular functions. Its precise physiological role remains largely unclear, but preliminary studies suggest that FLJ11305 may be related to stress response pathways and cellular signaling mechanisms. Researchers have hypothesized that dysregulation of FLJ11305 expression could be linked to certain pathological conditions, including cancer and metabolic disorders. Advances in recombinant protein technology have enabled scientists to produce FLJ11305 in a laboratory setting, facilitating further investigation into its structure and function. Various experimental approaches, including crystallography and molecular biology techniques, are being employed to elucidate the protein's three-dimensional conformation and interaction with other cellular components. Understanding the biological significance of FLJ11305 could provide insights into its potential as a therapeutic target or biomarker for specific diseases. Ongoing studies aim to unravel the molecular underpinnings of FLJ11305 and contribute to a broader understanding of its role in human health and disease.
