Analytical Data
-
Gene name
UBXD4
- Application
-
Alternative Names
UBXN2A; UBXD4; UBX domain-containing Protein 2A; UBX domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68543
-
Expression Region
1-259 aa
-
AA Sequence
MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQ VDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKN EICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWL ANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEADLQN AVIIQRLQKTASFRELSEH
-
Molecular Weight
29.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBXD4 is a member of the UBX domain-containing protein family, which plays a crucial role in the regulation of protein degradation and various cellular processes. It interacts with the proteasome and other components involved in the ubiquitin-proteasome system, contributing to the modulation of protein turnover and cellular homeostasis. Recent studies suggest that UBXD4 is implicated in several pathological conditions, including neurodegenerative diseases and cancer, highlighting its potential as a therapeutic target. Researchers are increasingly focused on the structural and functional characterization of UBXD4 recombinant protein to understand its mechanisms of action and biological significance. Through recombinant technology, scientists can produce purified UBXD4 to study its interactions with other proteins and cellular machinery, providing insights into its role in protein homeostasis. This research could illuminate how disruption of UBXD4 function contributes to disease mechanisms and may aid in the development of novel therapeutic strategies aimed at restoring proper protein regulation in affected cells. Overall, the study of UBXD4 recombinant protein is essential for advancing our understanding of cellular regulatory networks and their implications in health and disease.











