Analytical Data
-
Gene name
UBR2
- Application
-
Alternative Names
UBR2; C6orf133; KIAA0349; E3 ubiquitin-Protein ligase UBR2; EC 2.3.2.27; N-recognin-2; RING-type E3 ubiquitin transferase UBR2; Ubiquitin-Protein ligase E3-alpha-2; Ubiquitin-Protein ligase E3-alpha-II
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWV8
-
Expression Region
1-439 aa
-
AA Sequence
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYERLQSDYVTDDHDREFSVADLSVQIFTVPSLFSISAGRSGSPL
-
Molecular Weight
76.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBR2 (Ubiquitin-Protein Ligase E3 Component N-Recognin 2) is an essential enzyme involved in the ubiquitin-proteasome system, which plays a crucial role in regulating protein degradation and maintaining cellular homeostasis. It functions by recognizing and tagging substrates for ubiquitination, a process pivotal for the control of various cellular processes, including cell cycle progression, gene expression, and response to stress. Recent studies have highlighted UBR2's involvement in numerous biological functions and diseases, such as cancer and neurodegenerative disorders, linking its dysregulation to pathological conditions. Researchers have focused on the structural and functional characterization of UBR2, aiming to uncover its substrate specificity and the molecular mechanisms underlying its activity. Understanding UBR2 through recombinant protein research not only enhances our knowledge of protein quality control but also opens up potential therapeutic avenues for diseases associated with protein misfolding and degradation. Additionally, UBR2's role in modulating signaling pathways and cellular stress responses has provided insights into its potential as a biomarker and a target for drug development. Overall, the study of UBR2 recombinant protein serves as a critical step in elucidating its functions and implications in health and disease.
