Analytical Data
-
Gene name
CCDC3
- Application
-
Alternative Names
CCDC3；Coiled-coil domain-containing Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQI4
-
Expression Region
22-270aa
-
AA Sequence
CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG
-
Molecular Weight
32.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC3 (Coiled-Coil Domain Containing 3) is a protein encoded by the CCDC3 gene, and it has garnered attention in recent years due to its potential involvement in various cellular processes, including cell division, proliferation, and differentiation. Research has suggested that CCDC3 may play a significant role in the formation and stability of the cytoskeleton, which is crucial for maintaining cell shape and facilitating intracellular transport. Importantly, studies have hinted at its potential implications in certain diseases, including cancer and congenital disorders, due to its association with chromosomal stability and critical cellular functions. Moreover, CCDC3 has been implicated in the regulation of gene expression and the maintenance of cell integrity. Investigating CCDC3 as a recombinant protein allows researchers to delve deeper into its structural and functional characteristics, paving the way for understanding its roles in health and disease. This research not only enhances our knowledge of CCDC3’s biological significance but also opens avenues for therapeutic interventions targeting this protein in various pathologies, showcasing its potential as a biomarker or a therapeutic target in regenerative medicine and oncology. The recombinant expression of CCDC3 facilitates studies on its interactions with other cellular proteins and molecular pathways, further elucidating its function within the cellular landscape. Overall, the study of CCDC3 as a recombinant protein represents a crucial step towards uncovering the intricate mechanisms that govern cellular behavior and the potential clinical applications stemming from this knowledge.
