Analytical Data
-
Gene name
ZNF781
- Application
-
Alternative Names
ZNF781Zinc finger Protein 781
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8C0
-
Expression Region
1-327 aa
-
AA Sequence
MQRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQHNRIHTGGKPYECKECGKVFICCSTLIQHKRTHTSEKPYECLECRKTFRRSAHLIRHQRIHTGEKPYKCKQCWKAFASVSDLIDIGKFTLMRDFTNVQNVGRHLTIAQLLFSIREFTLVRSPLNVRNVAKHSIIAQHLLNTRELILMRNLMNVRNVKRLLGKVHILLNIKEFILVRNHMSVSNVGRLSLVFLILIDIREFTLVKNPMNVKNVVELLTIVQLLFNTREFTLVRRLMNISSVGRFLSPVQHLFNIREHILMKNLMNVSNARRPSSIMHI
-
Molecular Weight
64.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF781 (Zinc Finger Protein 781) is a member of the zinc finger protein family, which is known for its role in DNA binding and gene regulation. This protein has garnered attention in recent years due to its potential involvement in various biological processes, including cell differentiation, apoptosis, and the immune response. Recent studies have suggested that ZNF781 may play a critical role in the regulation of genes associated with tumor suppression, making it a potential candidate for cancer research. The functional characterization of ZNF781 through recombinant protein studies is essential for elucidating its mechanistic roles in cellular pathways. Researchers aim to express ZNF781 as a recombinant protein to investigate its structure, binding capabilities, and interactions with other proteins. Additionally, understanding the post-translational modifications of ZNF781 could provide insights into its regulatory mechanisms. These investigations may ultimately contribute to the development of novel therapeutic strategies targeting ZNF781 for various diseases, particularly cancers. Given the complexity of gene regulation, further exploration of ZNF781's role in the context of different pathologies may reveal significant insights into its function and broader implications in molecular biology.
