Analytical Data
-
Gene name
ZNF674
- Application
-
Alternative Names
MENTAL RETARDATION. X LINKED 92; MRX92; Zinc finger family member 674; Zinc finger Protein 674; ZN674_HUMAN; ZNF673B; ZNF674
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2M3X9
-
Expression Region
1-581 aa
-
AA Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVGKPDVIFRLGPGDESWMADGGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESGQECKICRKIIYLNTDFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKKDDGCKAYWKVCLHYNLHKAQPAERFFDPNQRGKALHQKQALRKSQRSQTGEKLYKCTECGKVFIQKANLVVHQRTHTGEKPYECCECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQRTHTGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCSEHGKASDEKPSPTKHWRTHTKENIYECSKCGKSFRGKSHLSVHQRIHTGEKPYECSICGKTFSGKSHLSVHHRTHTGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYKCNECGKAFSEKSPLIKHQRIHTGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCSECGKAFSVKSTLIVHHRTHTGEKPYECRDCGKAFSGKSTLIKHQRSHTGDKNL
-
Molecular Weight
90.31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF674 (Zinc Finger Protein 674) is a member of the zinc finger protein family, which plays crucial roles in various biological processes, including gene regulation, DNA binding, and protein-protein interactions. Given the significance of zinc finger proteins in cellular functions and their involvement in multiple disease pathways, including cancer and developmental disorders, ZNF674 has garnered attention for its potential regulatory roles. Studies have indicated that ZNF674 may be involved in modulating gene expression and cellular signaling pathways. Despite these insights, the functional role of ZNF674 remains largely uncharacterized, and there is limited information regarding its structural properties. The production of recombinant ZNF674 protein enables researchers to investigate its biochemical properties and interactions in vitro, providing a platform for understanding its function in cellular contexts. This research is pivotal for elucidating the physiological and pathological roles of ZNF674, which may lead to novel therapeutic strategies targeting diseases associated with dysregulation of this protein. By employing techniques such as X-ray crystallography and mass spectrometry, scientists aim to decipher the structural dynamics of ZNF674, revealing insights into its mechanisms of action and potential implications in health and disease. Overall, the study of recombinant ZNF674 protein represents a critical step in unravelling the complex roles of this intriguing zinc finger protein.
