Cat: PAX2000-12977

Recombinant Human ZNF673 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF673

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Protein ZNF673; RP4-733D15.4; zinc finger family member 673 ; ZN673_HUMAN; ZNF673

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5JUW0

  • Expression Region

    1-98 aa

  • AA Sequence

    MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPDVSIFASCILKCCY

  • Molecular Weight

    37.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNF673, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in various cellular processes and disease mechanisms. This protein is characterized by the presence of multiple zinc-finger motifs, which typically mediate protein-DNA interactions, suggesting that ZNF673 may function as a transcription factor influencing gene expression. Research indicates that ZNF673 is involved in critical biological processes such as cell proliferation, differentiation, and apoptosis, which are fundamental to normal development and tissue homeostasis. Furthermore, emerging studies have implicated ZNF673 in the pathogenesis of several diseases, including cancer, where it may contribute to tumorigenesis through dysregulation of target genes. The ability to produce recombinant ZNF673 protein allows for detailed functional analyses, facilitating the exploration of its molecular mechanisms and potential as a therapeutic target. Understanding the precise role of ZNF673 in cellular pathways could lead to novel insights in both basic biology and the treatment of diseases associated with its dysfunction. Additionally, the generation of antibodies against recombinant ZNF673 opens avenues for further in vivo studies to elucidate its biological significance and clinical relevance. As research progresses, ZNF673 stands out as a promising candidate for future investigations aimed at unraveling its contributions to health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US