Analytical Data
-
Gene name
RNASE2
- Application
-
Alternative Names
RNASE2；EDN；RNS2；Non-secretory ribonuclease
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10153
-
Expression Region
28-161aa
-
AA Sequence
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
-
Molecular Weight
17.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNASE2, a member of the ribonuclease family, plays a significant role in various biological processes, including antiviral defense and cellular RNA metabolism. Its enzymatic activity involves the degradation of RNA, which can influence gene expression regulation and the immune response. Recent studies have highlighted the potential therapeutic applications of RNASE2 due to its ability to target viral RNA, making it a candidate for antiviral drug development. Furthermore, dysregulation of RNASE2 has been associated with several diseases, such as cancer and autoimmune disorders, prompting researchers to explore its functional mechanisms and interactions within cellular pathways. The production of recombinant RNASE2 protein allows researchers to study its structural properties, enzymatic functions, and potential interactions with other biomolecules in a controlled environment. By elucidating the biochemical characteristics and biological roles of RNASE2, such studies aim to uncover new insights into its relevance in health and disease, ultimately contributing to the development of novel therapeutic strategies. The ongoing exploration of RNASE2 also raises questions about the evolutionary conservation of its functions and the broader implications of ribonucleases in cellular regulation and organismal biology.
