Analytical Data
-
Gene name
TXNDC10
- Application
-
Alternative Names
KIAA1830; PDIA13; Protein disulfide isomerase family A. member 13; Protein disulfide-isomerase TMX3; Thioredoxin domain containing 10; Thioredoxin domain-containing Protein 10; Thioredoxin-related transmembrane Protein 3; TMX3; TMX3_HUMAN; TXNDC10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JJ7
-
Expression Region
25-195 aa
-
AA Sequence
KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TXNDC10, or Thioredoxin Domain Containing 10, is a protein that has garnered significant interest in the field of molecular biology due to its potential roles in cellular processes such as redox regulation, protein folding, and stress responses. Researchers have identified TXNDC10 as a member of the thioredoxin family, which is essential for maintaining the cellular redox balance and facilitating proper protein maturation in various biological contexts. Its involvement in the regulation of oxidative stress and protein misfolding has positioned TXNDC10 as a potential therapeutic target for several diseases, including neurodegenerative disorders and certain types of cancer. Notably, the expression and activity of TXNDC10 can be influenced by various stressors, making it a valuable biomarker for cellular health and disease states. The study of TXNDC10 aims to elucidate its functional mechanisms, structure-activity relationships, and implications in disease biology, ultimately contributing to the development of novel therapeutic strategies that may harness the protective properties of this protein. Through the characterization of TXNDC10's role in cellular pathways, researchers hope to uncover its potential as a modulator of oxidative stress, offering insights into the treatment of diseases associated with oxidative damage and cellular dysfunction. The ongoing exploration of TXNDC10 represents a significant frontier in understanding cellular homeostasis and developing interventions to combat oxidative stress-related pathologies.
