Analytical Data
-
Gene name
FCAMR
- Application
-
Alternative Names
CD351; Fc alpha/mu receptor; Fc receptor. IgA. IgM. high affinity; Fcamr; FCAMR_HUMAN; FKSG87; High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor; Immunity related factor; Receptor for Fc fragment of IgA and IgM
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWV6
-
Expression Region
63-170aa
-
AA Sequence
TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of FCAMR (Fc alpha receptor) recombinant proteins is rooted in the need to understand the immune system's response to pathogens and its regulation through antibody interactions. FCAMR is a type of receptor that binds to the Fc region of immunoglobulin A (IgA), playing a crucial role in antibody-dependent cellular phagocytosis and inflammation. Research has increasingly indicated that FCAMR is pivotal for mucosal immunity, particularly in the gut and respiratory tract, where IgA is the primary antibody. Investigating FCAMR recombinant proteins allows scientists to explore its structure-function relationships and the mechanisms by which it influences immune responses. By generating recombinant forms of FCAMR, researchers aim to dissect its signaling pathways, explore its potential in modulating immune responses, and assess its therapeutic implications in diseases where IgA plays a pathological role, such as autoimmune disorders and chronic infections. Understanding FCAMR's functionality could lead to novel immunotherapeutic strategies, reinforcing its importance in the broader context of immunology and disease management.
