Analytical Data
-
Gene name
ZNF664
- Application
-
Alternative Names
ZFOC1; Zinc finger Organ of Corti 1; Zinc finger Protein 176; Zinc finger Protein 664; Zinc finger Protein from organ of Corti; ZN664_HUMAN; ZNF176; Znf664
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N3J9
-
Expression Region
1-261 aa
-
AA Sequence
MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI
-
Molecular Weight
56.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF664, a member of the zinc finger protein family, has garnered attention in recent years due to its potential role in gene regulation and development. It is characterized by multiple C2H2 zinc finger domains, which are typically involved in DNA binding and transcriptional regulation. Studies have shown that ZNF664 is expressed in various tissues, particularly during early developmental stages, suggesting its involvement in key biological processes such as cell differentiation and proliferation. Dysregulation of ZNF664 has been linked to several diseases, including cancer, thereby highlighting the necessity for understanding its functional mechanisms. The recombinant expression of ZNF664 in laboratory settings enables researchers to explore its biochemical properties, interaction partners, and regulatory pathways in detail. By producing the protein in suitable expression systems, scientists can conduct functional assays to elucidate its role in cellular processes, enhancing our understanding of its contributions to both normal physiology and pathophysiology. Consequently, the study of ZNF664’s recombinant protein is crucial for uncovering its potential as a therapeutic target and for developing innovative strategies in disease management.
