Cat: PA2000-7623

Recombinant Human FBXO41 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBXO41

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    F box protein 41; F-box only protein 41; FBX41; FBX41_HUMAN; FBXO41

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TF61

  • Expression Region

    400-498aa

  • AA Sequence

    DHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSSPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGG

  • Molecular Weight

    94.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBXO41 is a member of the F-box protein family, which is primarily involved in the ubiquitin-proteasome system, regulating protein degradation and thereby influencing various cellular processes such as cell cycle progression, apoptosis, and signal transduction. The ubiquitin-mediated degradation pathway, wherein F-box proteins serve as substrates for skp1-cullin-F-box (SCF) E3 ligase complexes, highlights FBXO41's role in modulating the levels of specific target proteins. Recent studies indicate that FBXO41 may play a critical role in cancer biology, particularly in the context of tumor progression and metastasis, by regulating proteins associated with cell cycle control and apoptosis. Moreover, FBXO41 has been implicated in the maintenance of stem cell properties and differentiation, suggesting that its functional attributes could extend to developmental biology. Given its involvement in these crucial pathways, FBXO41 has emerged as a potential therapeutic target, warranting further investigation into its mechanistic roles and interactions within cellular networks. Understanding FBXO41's functions and regulatory mechanisms could unveil novel strategies for tackling diseases where dysregulation of protein degradation is a hallmark, such as cancer and other proliferative disorders. Thus, the study of recombinant FBXO41 protein not only enhances our understanding of its biological roles but also opens avenues for the development of targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US