Analytical Data
-
Gene name
TUBB4Q
- Application
-
Alternative Names
Tubulin beta chain
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
I0CMK4
-
Expression Region
1-434 aa
-
AA Sequence
MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
-
Molecular Weight
74.69 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TUBB4Q is a member of the tubulin family of proteins, integral to the structure and function of microtubules, which are crucial components of the cytoskeleton in eukaryotic cells. Mutations in the TUBB4Q gene have been linked to various neurological disorders, including infantile hypotonia with psychomotor delay and hereditary spastic paraplegia. These conditions highlight the importance of TUBB4Q in neuronal development and function. Research into TUBB4Q recombinant proteins aims to elucidate the mechanistic pathways through which TUBB4Q mutations contribute to disease, providing insights into microtubule dynamics and neuronal integrity. By studying the structural and functional properties of TUBB4Q, scientists hope to develop potential therapeutic strategies for associated disorders, advancing our understanding of both basic cellular biology and clinical implications. The production of recombinant TUBB4Q proteins enables detailed biochemical assays and structural studies, facilitating the investigation of its interaction with other cytoskeletal components and its role in cellular processes such as mitosis, intracellular transport, and neuronal signaling. Thus, TUBB4Q emerges as a significant focus in both basic research and potential therapeutic development for neurodegenerative diseases.
