Cat: PA1000-8507

Recombinant Human GPX5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPX5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPX5;Epididymal secretory glutathione peroxidase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75715

  • Expression Region

    1-100aa

  • AA Sequence

    MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

  • Molecular Weight

    42.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPX5 (glutathione peroxidase 5) is a member of the glutathione peroxidase family, which plays a crucial role in protecting cells from oxidative stress by reducing hydrogen peroxide and other reactive oxygen species. This enzyme is particularly interesting due to its unique expression pattern, which is primarily observed in the male reproductive system, specifically in the epididymis. Research has indicated that GPX5 is involved in sperm maturation and function, suggesting its potential significance in male fertility. Dysregulation of GPX5 has been linked to various reproductive disorders, making it a target of interest for investigating male infertility. Moreover, GPX5 has been shown to possess antioxidant properties that could have broader implications in cellular health and longevity. The study of recombinant GPX5 offers insights into its structural and functional characteristics, providing a platform for exploring its therapeutic potential. By generating and characterizing recombinant GPX5, researchers aim to unravel its mechanism of action, assess its enzymatic activity, and explore its interactions with other cellular components. This work is essential for developing strategies to manipulate GPX5 levels for therapeutic benefits in reproductive health and oxidative stress-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US