Analytical Data
-
Gene name
OPG
- Application
-
Alternative Names
OPG;OCIF;OPG;;Tumor necrosis factor receptor superfamily member 11B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00300
-
Expression Region
22-401aa
-
AA Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYT DSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKH RSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGL LLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLS VLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKII QDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKP SDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRF LHSFTMYKLYQKLFLEMIGNQVQSVKISCL
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OPG (Osteoprotegerin) is a soluble receptor belonging to the tumor necrosis factor (TNF) superfamily, primarily known for its role in regulating bone metabolism and maintaining bone density by inhibiting osteoclast differentiation. Discovered in the late 1990s, OPG functions as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-Β Ligand), preventing it from binding to its receptor RANK on osteoclast precursor cells, thereby inhibiting osteoclastogenesis and promoting osteoblast activity. The dysregulation of OPG signaling has been implicated in various bone-related diseases, including osteoporosis, rheumatoid arthritis, and multiple myeloma, highlighting the need for targeted therapeutic strategies. Research has focused on the potential of OPG and its recombinant forms as a biomarker for osteoporosis risk assessment and as a therapeutic agent to counteract bone loss. Recent studies have explored the recombinant production of OPG to enable the development of novel drugs that can effectively modulate osteoclast activity and promote bone health. Additionally, innovative delivery methods and formulations are being investigated to enhance the bioavailability and efficacy of recombinant OPG. Understanding the intricate mechanisms involving OPG and its interactions in bone biology continues to be a significant area of research, as it may lead to breakthroughs in treating osteoporosis and other metabolic bone disorders. The ongoing exploration of OPG in both basic and clinical settings promises advancements in our approaches to managing bone diseases and improving patient outcomes.











