Analytical Data
-
Gene name
ZNF614
- Application
-
Alternative Names
FLJ21941; MGC120638; Zinc finger Protein 614; ZN614_HUMAN; ZNF614
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N883
-
Expression Region
1-198 aa
-
AA Sequence
MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGETGSLERPRQADHLRSEVQDQPGQRGETLCLLKIHTKN
-
Molecular Weight
49.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF614, a member of the zinc finger protein family, has garnered significant attention in recent years due to its potential roles in gene regulation and cellular processes. This protein is characterized by the presence of multiple zinc finger motifs, which are known to facilitate DNA binding and protein-protein interactions. Research suggests that ZNF614 may be involved in critical biological functions such as developmental processes, cell differentiation, and responses to environmental stimuli. Furthermore, emerging evidence indicates that ZNF614 might play a pivotal role in various diseases, including cancers and genetic disorders, making it an intriguing target for therapeutic interventions. The ability to produce recombinant ZNF614 protein in a controlled laboratory setting is vital for comprehensively understanding its biochemical properties, interaction networks, and functional implications. By utilizing techniques such as recombinant DNA technology and expression systems, researchers aim to elucidate the structure-function relationships of ZNF614, paving the way for innovative strategies in drug development and disease treatment. Understanding this protein's mechanism of action could provide new insights into its potential as a biomarker or therapeutic target in various medical applications. The exploration of ZNF614 promises not only to enhance our understanding of gene regulation but also to contribute to the broader field of molecular biology and medicine.
