Analytical Data
-
Gene name
ZNF607
- Application
-
Alternative Names
ZNF607Zinc finger Protein 607
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96SK3
-
Expression Region
1-156 aa
-
AA Sequence
MAAKVFESIGKFGLALAVAGGMVTSALCNVDAGHRAAIFDQFRGVQNIVVGEGTHFLIPCVQKPIIFDCCSQPRSAPVITGSKDLQNVNITLCILFRPITSQLPRIFTSIGEDYDECVLPFITTEILKSLVARFDAGELITQRELVSSQVSNNLME
-
Molecular Weight
43.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF607, a member of the zinc finger protein family, has garnered increasing attention in the field of molecular biology due to its potential roles in gene regulation, development, and cellular differentiation. Recent studies have suggested that ZNF607 may be involved in various biological processes, including transcriptional regulation and chromatin remodeling, which are crucial for maintaining normal cellular function and responding to environmental cues. Abnormal expression or mutation of ZNF607 has been linked to several diseases, including cancer, making it a promising target for therapeutic interventions. The recombinant expression of ZNF607 in various systems enables researchers to investigate its structural and functional characteristics, paving the way for understanding its mechanistic contributions to cellular processes. By producing ZNF607 as a recombinant protein, scientists can conduct detailed studies on its interactions with DNA and other cellular components, ultimately elucidating its role in health and disease. Understanding the functionality of ZNF607 could provide insights into its potential as a biomarker for certain conditions and its viability as a target for drug development, underscoring the importance of ongoing research in this area.
