Analytical Data
-
Gene name
FBXO24
- Application
-
Alternative Names
FBXO24; FBX24F-box only protein 24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75426
-
Expression Region
1-580aa
-
AA Sequence
MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVLCRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTFHHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKILFCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSLVLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET
-
Molecular Weight
91.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXO24 is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome system, a key pathway for protein degradation and cellular regulation. The F-box proteins are characterized by their ability to recruit specific substrates for ubiquitination, thus marking them for degradation. FBXO24, in particular, has been implicated in various biological processes, including cell cycle regulation and responses to stress. Recent studies suggest that FBXO24 may be involved in the development of certain cancers, as its expression levels and activity can affect tumor progression and response to therapy. Understanding the structure and function of FBXO24 is vital for elucidating its potential roles in disease mechanisms and therapeutic applications. Researchers have been focusing on the recombination and characterization of FBXO24 to investigate its interactions with other cellular proteins and pathways, with the goal of revealing its contribution to the pathology of diseases. Advanced techniques, such as crystallography and mass spectrometry, are being utilized to elucidate its structure-function relationship. The findings may not only enhance our understanding of FBXO24 but also pave the way for the development of novel therapeutic strategies targeting the ubiquitin-proteasome system in cancer and other disorders. This research holds promise for uncovering new insights into protein homeostasis and cellular signaling, with implications for both fundamental biology and clinical applications.
