Analytical Data
-
Gene name
ZNF585A
- Application
-
Alternative Names
ZNF585A; Zinc finger Protein 585A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P3V2
-
Expression Region
1-113 aa
-
AA Sequence
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSIGYQVPEAEVVMLEQGKEPWALQGERPRQSCPAPCLVNSHHLQESFRG
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF585A (Zinc Finger Protein 585A) is a member of the zinc finger protein family, which are known for their roles in DNA binding and regulation of gene expression. Research into ZNF585A has gained interest due to its potential involvement in various biological processes and diseases, including cancer and neurological disorders. Expression studies have indicated that ZNF585A may play a role in cellular stress responses and differentiation, suggesting its importance in maintaining cellular homeostasis. Moreover, its localization to the nucleus and interaction with other proteins hint at its regulatory functions in transcriptional control. The characterization of ZNF585A as a recombinant protein allows for further exploration of its biochemical properties, interaction partners, and functional roles. Understanding the structure and function of ZNF585A could provide insights into its mechanism of action, potentially leading to therapeutic applications in diseases linked with its dysregulation. As research progresses, recombinant ZNF585A may serve as a valuable tool for dissecting the molecular underpinnings of diseases and could contribute to the development of novel strategies for intervention and treatment.
