Analytical Data
-
Gene name
CASP8
- Application
-
Alternative Names
CASP8；MCH5；Caspase-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14790
-
Expression Region
217–374aa
-
AA Sequence
SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
-
Molecular Weight
21.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caspase-8 (CASP8) is a pivotal enzyme in the apoptosis signaling pathway, primarily functioning as an initiator caspase in death receptor-mediated apoptosis. It plays a critical role in regulating the cell death processes necessary for maintaining tissue homeostasis and immune system function. Dysregulation of CASP8 has been implicated in various diseases, including cancer, autoimmunity, and neurodegenerative disorders, making it significant for therapeutic research. Understanding CASP8’s structure and function is essential for developing targeted therapies aimed at modulating apoptotic pathways in disease states. Recent studies have focused on the recombinant production of CASP8 to facilitate detailed investigations of its enzymatic activity, substrate specificity, and interaction with other apoptotic regulators. By generating a high-purity recombinant form of CASP8, researchers can conduct in vitro assays to uncover its mechanisms of action, identify potential inhibitors or activators, and explore its potential as a biomarker for disease progression. Additionally, insights gained from CASP8 research have implications for the development of novel treatments that can sensitize cancer cells to apoptosis or restore apoptotic signaling in diseases characterized by excessive cell survival. Overall, the study of recombinant CASP8 not only enhances our understanding of fundamental apoptotic processes but also holds promise for translating this knowledge into clinical applications.
