Analytical Data
-
Gene name
FBXL20
- Application
-
Alternative Names
FBXL20; FBL2F-box/LRR-repeat protein 20; F-box and leucine-rich repeat protein 20; F-box/LRR-repeat protein 2-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96IG2
-
Expression Region
1-436aa
-
AA Sequence
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL
-
Molecular Weight
73.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXL20, a member of the F-box protein family, plays a crucial role in the ubiquitin-proteasome system, which is essential for regulating protein degradation and turnover within cells. The function of FBXL20 is primarily associated with its ability to recognize and bind specific target proteins for ubiquitination, marking them for degradation. Studies have indicated that FBXL20 is involved in various physiological processes, including cell cycle regulation, signal transduction, and the maintenance of stem cell pluripotency. Dysregulation of FBXL20 has been implicated in several diseases, particularly cancer, where aberrant protein degradation may contribute to tumorigenesis and disease progression. Additionally, recent research has highlighted the potential of FBXL20 as a therapeutic target, as manipulating its function could improve the efficacy of cancer treatments. Understanding the structure and function of FBXL20 recombinant proteins is vital for elucidating its role in cellular mechanisms and for the development of novel therapeutic strategies. As such, the generation and characterization of FBXL20 recombinant proteins are essential for investigating its interactions with substrates, defining its biochemical properties, and exploring its potential in disease models. This ongoing research aims to provide deeper insights into the multifunctional roles of FBXL20 and its relevance in both normal physiology and pathological conditions.
