Analytical Data
-
Gene name
ZNF576
- Application
-
Alternative Names
ZNF576Zinc finger Protein 576
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H609
-
Expression Region
1-170 aa
-
AA Sequence
MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL
-
Molecular Weight
45.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF576, a member of the zinc finger protein family, has garnered interest in recent years due to its potential roles in gene regulation, transcriptional control, and involvement in various biological processes. Zinc finger proteins are characterized by their ability to bind DNA, RNA, or proteins, facilitating critical interactions in cellular mechanisms. The specific function of ZNF576 remains largely unexplored, but evidence suggests it may play a role in cancer biology and developmental processes. Research has indicated that alterations in zinc finger proteins, like ZNF576, may contribute to oncogenesis and other pathophysiological conditions. Thus, the recombinant production of ZNF576 is essential for studying its structure-function relationship, understanding its interaction with other biomolecules, and elucidating its potential roles in disease mechanisms. Moreover, generating ZNF576 in a recombinant form allows for the development of targeted therapeutic strategies, including gene therapy or drug development aimed at modulating its activity. This underscores the importance of recombinant protein studies in advancing our understanding of ZNF576 and its implications in health and disease. Overall, the investigation of ZNF576 through recombinant techniques is a promising avenue for uncovering its biological significance and therapeutic potential.
