Cat: PA1000-8478

Recombinant Human PXDN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PXDN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PXDN;KIAA0230;MG50;PRG2;Peroxidasin homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92626

  • Expression Region

    1452-1561aa

  • AA Sequence

    STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDA GGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCP VCLQKRAEEK

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PXDN (Peroxidase Domain Containing Protein) is a member of the peroxidase enzyme family, which plays a crucial role in various biological processes, including the regulation of reactive oxygen species (ROS), cellular signaling, and immune responses. Recent studies have highlighted its potential involvement in inflammatory conditions and tumor biology, suggesting that PXDN may be a critical mediator in the oxidative stress response of cells. Given its diverse physiological roles, researchers have focused on understanding the structural and functional characteristics of PXDN, particularly through recombinant protein studies. The expression and purification of PXDN as a recombinant protein facilitate the investigation of its enzymatic activities, substrate specificity, and biological interactions. These studies are essential for elucidating the molecular mechanisms of PXDN in health and disease, ultimately paving the way for potential therapeutic applications targeting oxidative stress-related conditions. Moreover, as PXDN's role in the formation of extracellular matrix components and its implication in fibrosis have been recognized, researchers are actively exploring its potential as a biomarker and therapeutic target in fibrotic diseases. As such, the study of PXDN recombinant protein has become a significant area of interest, providing insights not only into fundamental biological processes but also into the development of novel strategies for the treatment of various diseases associated with oxidative stress and inflammation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US